IGF 1 DES 1,3
$59.99
IGF-1 DES (1-3) is an IGF-related peptide selected for muscle-repair, cellular-growth and training-recovery interest. This product is supplied in a lyophilized vial; see the current label for the exact active strength and package quantity.
Out of stock
This product is currently sold out.
No worries! Enter your email, and we'll let you know as soon as it's back in stock.
Description
Description
IGF-1 DES (1-3) is an IGF-related peptide selected for muscle-repair, cellular-growth and training-recovery interest. This product is supplied in a lyophilized vial; see the current label for the exact active strength and package quantity.
Customers receive a clearly identified IGF-1 DES (1-3) product with third-party testing, lot-specific documentation and straightforward storage information. Formula, molecular weight, mechanism and finished-product details are organized below for easy comparison.
Potential Benefits and Product Highlights
- May support muscle-cell repair and growth signaling.
- Studied for satellite-cell activation and tissue remodeling.
- Strong mechanistic interest for post-training recovery pathways.
- Short peptide format offers a distinct profile from full-length IGF-1.
- Independent third-party testing with lot-specific quality documentation.
Product Details
| Product name | IGF-1 DES (1-3) |
|---|---|
| Main category | Peptides |
| Subcategory | Growth Hormone Peptides |
| Product format | Lyophilized vial |
| Declared strength | See current product label |
| Active identity / composition | IGF-1 DES (1-3) |
| Quality documentation | Independent third-party testing and lot-specific Certificate of Analysis |
Chemical Information
| Compound | Amount | Molecular formula | Molecular weight | Sequence / structure |
|---|---|---|---|---|
| Des(1-3) insulin-like growth factor I; IGF-1 DES | See selected product presentation | C₃₁₉H₅₀₁N₉₁O₉₆S₇ | Approximately 7.37 kDa; disulfide form and analytical convention matter | TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Chemical nomenclature note: IGF-1 DES, des(1-3)IGF-I and des-Gly-Pro-Glu-IGF-I refer to the 67-residue truncated analogue. It is distinct from native IGF-1, IGF-1 LR3 and MGF. |
How It Works
IGF-related peptides activate growth and survival pathways that can influence protein synthesis, cell proliferation and tissue remodeling.
Tesamorelin – 5 mg / 10 mg offers another way to compare upstream or downstream growth-hormone-axis signaling.
Evidence note: Most performance claims are preclinical or mechanistic, and these potent growth pathways require careful professional oversight. Sources: Ballard FJ et al. Des(1-3)IGF-I review; Francis GL et al. IGF-I variants with reduced binding-protein affinity.
Product Strength and Usage Information
This product is supplied in a lyophilized vial; see the current label for the exact active strength and package quantity. Check the current label, serving or unit information and lot-specific documentation before use.
No single dosage suits every compound, goal or customer. Use should follow the product label and appropriate professional guidance, especially for potent hormones, prescription-class ingredients and investigational compounds.
Quality and Testing
Identity, purity and finished-product content are reviewed as separate quality attributes. The lot-specific Certificate of Analysis should identify the methods, results, batch number, testing provider and test date.
- Chromatographic testing evaluates purity and related substances.
- Mass spectrometry supports molecular identity and expected mass.
- Finished-product testing evaluates the supplied concentration, unit content, fill, count, uniformity or physical presentation as applicable.
- Lot-specific documentation supports confident purchasing and product traceability.
Storage and Handling
- Keep the sealed vial under the temperature conditions printed on the product label.
- Protect from light, moisture and repeated temperature changes.
- After reconstitution, follow the stated refrigeration and use-period instructions.
- Avoid repeated freeze-thaw cycles and inspect the vial before use.
Frequently Asked Questions
What is included in this product?
IGF-1 DES (1-3) supplied in a lyophilized vial with the declared composition and strength shown in the specifications.
What is IGF-1 DES (1-3)?
IGF-1 DES (1-3) is an IGF-related peptide selected for muscle-repair, cellular-growth and training-recovery interest.
What potential benefits are associated with it?
Potential areas of interest include may support muscle-cell repair and growth signaling, studied for satellite-cell activation and tissue remodeling, strong mechanistic interest for post-training recovery pathways.
How does it work?
IGF-related peptides activate growth and survival pathways that can influence protein synthesis, cell proliferation and tissue remodeling.
How strong is the evidence?
Most performance claims are preclinical or mechanistic, and these potent growth pathways require careful professional oversight.
How is product quality documented?
Independent third-party testing and a lot-specific Certificate of Analysis provide identity, purity and finished-product information.
How should the product be stored?
Keep the product in its original container and follow the temperature, light and handling conditions shown on the label.
What should be checked when the product arrives?
Review the product name, format, strength, lot number, container integrity and matching Certificate of Analysis.
Related products
Bacteriostatic Water for Injection, USP – 30 mL
BPC-157 (5mg, 10mg)
MOTS-c – 10mg
GLP-2 Injection Vial (5mg, 10mg, 30mg)
Sermorelin 10mg Multi-Use Vial
Semax (30mg)
